SCOPe 2.03: Domain d1hu8b_: 1hu8 B:

Lineage for d1hu8b_ (1hu8 B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (7 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [63683] (1 PDB entry)

8. Domain d1hu8b_: 1hu8 B: [61270]
   complexed with zn

Details for d1hu8b_

PDB Entry: 1hu8, 2.7 Å

PDB Description: crystal structure of the mouse p53 core dna-binding domain at 2.7a resolution

PDB Compounds: (B:) Cellular tumor antigen p53

SCOPe Domain Sequences for d1hu8b_:

Sequence; same for both SEQRES and ATOM records:

>d1hu8b_ b.2.5.2 (B:) p53 tumor suppressor, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]}
tyqgnygfhlgflqsgtaksvmctyspplnklfcqlaktcpvqlwvsatppagsrvrama
iykksqhmtevvrrcphhercsdgdglappqhlirvegnlapeyledrqtfrhsvvvpye
ppeagseyttihykymcnsscmggmnrrpiltiitledssgnllgrdsfevrvcacpgrd
rrteee

Timeline for d1hu8b_:

• d1hu8b_ first appeared in SCOP 1.57
  
• d1hu8b_ appears in SCOPe 2.02
  
• d1hu8b_ appears in SCOPe 2.04
  
• d1hu8b_ appears in the current release, SCOPe 2.08