Lineage for d1hu8b_ (1hu8 B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55312Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 55415Superfamily b.2.5: p53-like transcription factors [49417] (1 family) (S)
  5. 55416Family b.2.5.1: p53-like transcription factors [49418] (10 proteins)
  6. 55449Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 55458Species Mouse (Mus musculus) [TaxId:10090] [63683] (1 PDB entry)
  8. 55460Domain d1hu8b_: 1hu8 B: [61270]

Details for d1hu8b_

PDB Entry: 1hu8 (more details), 2.7 Å

PDB Description: crystal structure of the mouse p53 core dna-binding domain at 2.7a resolution

SCOP Domain Sequences for d1hu8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hu8b_ b.2.5.1 (B:) p53 tumor suppressor, DNA-binding domain {Mouse (Mus musculus)}
tyqgnygfhlgflqsgtaksvmctyspplnklfcqlaktcpvqlwvsatppagsrvrama
iykksqhmtevvrrcphhercsdgdglappqhlirvegnlapeyledrqtfrhsvvvpye
ppeagseyttihykymcnsscmggmnrrpiltiitledssgnllgrdsfevrvcacpgrd
rrteee

SCOP Domain Coordinates for d1hu8b_:

Click to download the PDB-style file with coordinates for d1hu8b_.
(The format of our PDB-style files is described here.)

Timeline for d1hu8b_: