SCOP 1.63: Domain d1htze_: 1htz E:

Lineage for d1htze_ (1htz E:)

1. Root: SCOP 1.63

2. Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)

3. Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (9 proteins)

6. Protein beta-Lactamase, class A [56606] (13 species)

7. Species Klebsiella pneumoniae, TEM52 [TaxId:573] [64473] (1 PDB entry)

8. Domain d1htze_: 1htz E: [61266]

Details for d1htze_

PDB Entry: 1htz, 2.4 Å

PDB Description: crystal structure of tem52 beta-lactamase

SCOP Domain Sequences for d1htze_:

Sequence; same for both SEQRES and ATOM records:

>d1htze_ e.3.1.1 (E:) beta-Lactamase, class A {Klebsiella pneumoniae, TEM52}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlvkyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgasergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

Timeline for d1htze_:

• d1htze_ first appeared in SCOP 1.57
  
• d1htze_ appears in SCOP 1.61
  
• d1htze_ appears in SCOP 1.65
  
• d1htze_ appears in the current release, SCOPe 2.08