Lineage for d1htza_ (1htz A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2244157Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2244418Protein beta-Lactamase, class A [56606] (16 species)
  7. 2244634Species Klebsiella pneumoniae, TEM52 [TaxId:573] [64473] (1 PDB entry)
  8. 2244635Domain d1htza_: 1htz A: [61262]
    mutant

Details for d1htza_

PDB Entry: 1htz (more details), 2.4 Å

PDB Description: crystal structure of tem52 beta-lactamase
PDB Compounds: (A:) beta-lactamase mutant tem52

SCOPe Domain Sequences for d1htza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htza_ e.3.1.1 (A:) beta-Lactamase, class A {Klebsiella pneumoniae, TEM52 [TaxId: 573]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlvkyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgasergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d1htza_:

Click to download the PDB-style file with coordinates for d1htza_.
(The format of our PDB-style files is described here.)

Timeline for d1htza_: