SCOPe 2.06: Domain d1htzb_: 1htz B:

Lineage for d1htzb_ (1htz B:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Klebsiella pneumoniae, TEM52 [TaxId:573] [64473] (1 PDB entry)

8. Domain d1htzb_: 1htz B: [61263]
   mutant

Details for d1htzb_

PDB Entry: 1htz, 2.4 Å

PDB Description: crystal structure of tem52 beta-lactamase

PDB Compounds: (B:) beta-lactamase mutant tem52

SCOPe Domain Sequences for d1htzb_:

Sequence; same for both SEQRES and ATOM records:

>d1htzb_ e.3.1.1 (B:) beta-Lactamase, class A {Klebsiella pneumoniae, TEM52 [TaxId: 573]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlvkyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgasergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

Timeline for d1htzb_:

• d1htzb_ first appeared in SCOP 1.57
  
• d1htzb_ appears in SCOPe 2.05
  
• d1htzb_ appears in SCOPe 2.07
  
• d1htzb_ appears in the current release, SCOPe 2.08