Lineage for d1hsjb2 (1hsj B:1-372)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2521049Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 2521076Species Escherichia coli [TaxId:562] [53863] (69 PDB entries)
    Uniprot P02928
  8. 2521127Domain d1hsjb2: 1hsj B:1-372 [61240]
    Other proteins in same PDB: d1hsja1, d1hsjb1
    fusion protein with SarR
    protein/DNA complex; complexed with glc

Details for d1hsjb2

PDB Entry: 1hsj (more details), 2.3 Å

PDB Description: sarr mbp fusion structure
PDB Compounds: (B:) fusion protein consisting of staphylococcus accessory regulator protein r and maltose binding protein

SCOPe Domain Sequences for d1hsjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hsjb2 c.94.1.1 (B:1-372) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
laaaqtnaaaef

SCOPe Domain Coordinates for d1hsjb2:

Click to download the PDB-style file with coordinates for d1hsjb2.
(The format of our PDB-style files is described here.)

Timeline for d1hsjb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hsjb1