| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
| Protein Staphylococcal accessory regulator A homolog, SarR [63472] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [63473] (1 PDB entry) |
| Domain d1hsja1: 1hsj A:373-487 [61237] Other proteins in same PDB: d1hsja2, d1hsjb2 Fusion protein with E. coli MBP protein/DNA complex; complexed with glc |
PDB Entry: 1hsj (more details), 2.3 Å
SCOPe Domain Sequences for d1hsja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hsja1 a.4.5.28 (A:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]}
mskindindlvnatfqvkkffrdtkkkfnlnyeeiyilnhilrsesneisskeiakcsef
kpyyltkalqklkdlkllskkrslqdertvivyvtdtqkaniqkliseleeyikn
Timeline for d1hsja1: