SCOPe 2.02: Domain d1hsjb2: 1hsj B:1-372

Lineage for d1hsjb2 (1hsj B:1-372)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
   contains a few additional helices in the C-terminal extension; homologous to thiaminase I

7. Species Escherichia coli [TaxId:562] [53863] (47 PDB entries)
   Uniprot P02928

8. Domain d1hsjb2: 1hsj B:1-372 [61240]
   Other proteins in same PDB: d1hsja1, d1hsjb1
   fusion protein with SarR
   protein/DNA complex; complexed with glc

Details for d1hsjb2

PDB Entry: 1hsj, 2.3 Å

PDB Description: sarr mbp fusion structure

PDB Compounds: (B:) fusion protein consisting of staphylococcus accessary regulator protein r and maltose binding protein

SCOPe Domain Sequences for d1hsjb2:

Sequence; same for both SEQRES and ATOM records:

>d1hsjb2 c.94.1.1 (B:1-372) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdea
laaaqtnaaaef

Timeline for d1hsjb2:

• d1hsjb2 first appeared in SCOP 1.57
  
• d1hsjb2 appears in SCOPe 2.01
  
• d1hsjb2 appears in SCOPe 2.03
  
• d1hsjb2 appears in the current release, SCOPe 2.08