SCOP 1.61: Domain d1hsjb1: 1hsj B:373-487

Lineage for d1hsjb1 (1hsj B:373-487)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (35 families)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (3 proteins)

6. Protein staphylococcal accessory regulator A homolog, SarR [63472] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [63473] (1 PDB entry)

8. Domain d1hsjb1: 1hsj B:373-487 [61239]
   Other proteins in same PDB: d1hsja2, d1hsjb2

Details for d1hsjb1

PDB Entry: 1hsj, 2.3 Å

PDB Description: sarr mbp fusion structure

SCOP Domain Sequences for d1hsjb1:

Sequence; same for both SEQRES and ATOM records:

>d1hsjb1 a.4.5.28 (B:373-487) staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus}
mskindindlvnatfqvkkffrdtkkkfnlnyeeiyilnhilrsesneisskeiakcsef
kpyyltkalqklkdlkllskkrslqdertvivyvtdtqkaniqkliseleeyikn

Timeline for d1hsjb1:

• d1hsjb1 first appeared in SCOP 1.57
  
• d1hsjb1 appears in SCOP 1.59
  
• d1hsjb1 appears in SCOP 1.63
  
• d1hsjb1 appears in the current release, SCOPe 2.08