SCOP 1.67: Domain d1hpwa_: 1hpw A:

Lineage for d1hpwa_ (1hpw A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.24: Pili subunits [54522] (1 superfamily)
   contains very long N-terminal helix, which end is packed against beta-sheet

4. Superfamily d.24.1: Pili subunits [54523] (2 families)
   bacterial filament proteins

5. Family d.24.1.1: Pilin [54524] (1 protein)

6. Protein Pilin [54525] (3 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [64247] (1 PDB entry)

8. Domain d1hpwa_: 1hpw A: [61118]

Details for d1hpwa_

PDB Entry: 1hpw

PDB Description: structure of a pilin monomer from pseudomonas aeruginosa: implications for the assembly of pili.

SCOP Domain Sequences for d1hpwa_:

Sequence; same for both SEQRES and ATOM records:

>d1hpwa_ d.24.1.1 (A:) Pilin {Pseudomonas aeruginosa}
alegtefaraqlseamtlasglktkvsdifsqdgscpantaatagiekdtdingkyvakv
ttggtaaasggctivatmkasdvatplrgktltltlgnadkgsytwactsnadnkylpkt
cqtattttp

Timeline for d1hpwa_:

• d1hpwa_ first appeared in SCOP 1.57
  
• d1hpwa_ appears in SCOP 1.65
  
• d1hpwa_ appears in SCOP 1.69
  
• d1hpwa_ appears in the current release, SCOPe 2.08, called d1hpwa1