Lineage for d1hpwa_ (1hpw A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79001Fold d.24: Pilin [54522] (1 superfamily)
  4. 79002Superfamily d.24.1: Pilin [54523] (1 family) (S)
  5. 79003Family d.24.1.1: Pilin [54524] (1 protein)
  6. 79004Protein Pilin [54525] (3 species)
  7. 79008Species Pseudomonas aeruginosa [TaxId:287] [64247] (1 PDB entry)
  8. 79009Domain d1hpwa_: 1hpw A: [61118]

Details for d1hpwa_

PDB Entry: 1hpw (more details)

PDB Description: structure of a pilin monomer from pseudomonas aeruginosa: implications for the assembly of pili.

SCOP Domain Sequences for d1hpwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hpwa_ d.24.1.1 (A:) Pilin {Pseudomonas aeruginosa}
alegtefaraqlseamtlasglktkvsdifsqdgscpantaatagiekdtdingkyvakv
ttggtaaasggctivatmkasdvatplrgktltltlgnadkgsytwactsnadnkylpkt
cqtattttp

SCOP Domain Coordinates for d1hpwa_:

Click to download the PDB-style file with coordinates for d1hpwa_.
(The format of our PDB-style files is described here.)

Timeline for d1hpwa_: