Lineage for d1hpwa_ (1hpw A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501813Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 501814Superfamily d.24.1: Pili subunits [54523] (2 families) (S)
    bacterial filament proteins
  5. 501815Family d.24.1.1: Pilin [54524] (4 proteins)
  6. 501820Protein Pilin P1 [109619] (1 species)
  7. 501821Species Pseudomonas aeruginosa [TaxId:287] [64247] (3 PDB entries)
  8. 501826Domain d1hpwa_: 1hpw A: [61118]

Details for d1hpwa_

PDB Entry: 1hpw (more details)

PDB Description: structure of a pilin monomer from pseudomonas aeruginosa: implications for the assembly of pili.

SCOP Domain Sequences for d1hpwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hpwa_ d.24.1.1 (A:) Pilin P1 {Pseudomonas aeruginosa}
alegtefaraqlseamtlasglktkvsdifsqdgscpantaatagiekdtdingkyvakv
ttggtaaasggctivatmkasdvatplrgktltltlgnadkgsytwactsnadnkylpkt
cqtattttp

SCOP Domain Coordinates for d1hpwa_:

Click to download the PDB-style file with coordinates for d1hpwa_.
(The format of our PDB-style files is described here.)

Timeline for d1hpwa_: