Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
Superfamily c.80.1: SIS domain [53697] (4 families) |
Family c.80.1.2: Phosphoglucose isomerase, PGI [53701] (2 proteins) permutation of the double-SIS domain fold automatically mapped to Pfam PF00342 |
Protein Phosphoglucose isomerase, PGI [53702] (7 species) moonlights as neuroleukin, autocrine motility factor, and differentiation mediator |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53703] (6 PDB entries) |
Domain d1hoxa_: 1hox A: [61108] complexed with f6p |
PDB Entry: 1hox (more details), 2.1 Å
SCOPe Domain Sequences for d1hoxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hoxa_ c.80.1.2 (A:) Phosphoglucose isomerase, PGI {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} aaltrnpqfqklqqwhrehgselnlrhlfdtdkerfnhfsltlntnhghilldysknlvt eevmhmlldlaksrgveaaresmfngekinstedravlhvalrnrsntpivvdgkdvmpe vnkvldkmkafcqrvrsgdwkgytgktitdvinigiggsdlgplmvtealkpyssggprv wfvsnidgthiaktlaclnpesslfiiasktfttqetitnaktakdwfllsakdpstvak hfvalstntakvkefgidpqnmfefwdwvggryslwsaiglsialhvgfdnfeqllsgah wmdqhfrttpleknapvllamlgiwyincfgcetqavlpydqylhrfaayfqqgdmesng kyitksgarvdhqtgpivwgepgtngqhafyqlihqgtkmipcdflipvqtqhpirkglh hkillanflaqtealmkgksteearkelqaagkspedlmkllphkvfegnrptnsivftk ltpfilgaliamyehkifvqgvvwdinsfdqwgvelgkqlakkiepeldgsspvtshdss tnglinfikqqreak
Timeline for d1hoxa_: