Lineage for d1hoxa_ (1hox A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140302Family c.80.1.2: Phosphoglucose isomerase, PGI [53701] (2 protein domains)
    permutation of the double-SIS domain fold
    automatically mapped to Pfam PF00342
  6. 2140303Protein Phosphoglucose isomerase, PGI [53702] (8 species)
    moonlights as neuroleukin, autocrine motility factor, and differentiation mediator
  7. 2140339Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53703] (6 PDB entries)
  8. 2140346Domain d1hoxa_: 1hox A: [61108]
    complexed with f6p

Details for d1hoxa_

PDB Entry: 1hox (more details), 2.1 Å

PDB Description: crystal structure of rabbit phosphoglucose isomerase complexed with fructose-6-phosphate
PDB Compounds: (A:) phosphoglucose isomerase

SCOPe Domain Sequences for d1hoxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hoxa_ c.80.1.2 (A:) Phosphoglucose isomerase, PGI {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aaltrnpqfqklqqwhrehgselnlrhlfdtdkerfnhfsltlntnhghilldysknlvt
eevmhmlldlaksrgveaaresmfngekinstedravlhvalrnrsntpivvdgkdvmpe
vnkvldkmkafcqrvrsgdwkgytgktitdvinigiggsdlgplmvtealkpyssggprv
wfvsnidgthiaktlaclnpesslfiiasktfttqetitnaktakdwfllsakdpstvak
hfvalstntakvkefgidpqnmfefwdwvggryslwsaiglsialhvgfdnfeqllsgah
wmdqhfrttpleknapvllamlgiwyincfgcetqavlpydqylhrfaayfqqgdmesng
kyitksgarvdhqtgpivwgepgtngqhafyqlihqgtkmipcdflipvqtqhpirkglh
hkillanflaqtealmkgksteearkelqaagkspedlmkllphkvfegnrptnsivftk
ltpfilgaliamyehkifvqgvvwdinsfdqwgvelgkqlakkiepeldgsspvtshdss
tnglinfikqqreak

SCOPe Domain Coordinates for d1hoxa_:

Click to download the PDB-style file with coordinates for d1hoxa_.
(The format of our PDB-style files is described here.)

Timeline for d1hoxa_: