SCOP 1.69: Domain d1hh5a_: 1hh5 A:

Lineage for d1hh5a_ (1hh5 A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (3 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.1: Cytochrome c3-like [48696] (4 proteins)

6. Protein Cytochrome c7 (cytochrome c551.5, PpcA) [48703] (3 species)
   contains three heme groups; deletion of one of Cyt c3 heme-binding sites

7. Species Desulfuromonas acetoxidans [TaxId:891] [48704] (8 PDB entries)

8. Domain d1hh5a_: 1hh5 A: [61041]

Details for d1hh5a_

PDB Entry: 1hh5, 1.9 Å

PDB Description: cytochrome c7 from desulfuromonas acetoxidans

SCOP Domain Sequences for d1hh5a_:

Sequence; same for both SEQRES and ATOM records:

>d1hh5a_ a.138.1.1 (A:) Cytochrome c7 (cytochrome c551.5, PpcA) {Desulfuromonas acetoxidans}
advvtyenkkgnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt
kcggchik

Timeline for d1hh5a_:

• d1hh5a_ first appeared in SCOP 1.57
  
• d1hh5a_ appears in SCOP 1.67
  
• d1hh5a_ appears in SCOP 1.71
  
• d1hh5a_ appears in the current release, SCOPe 2.08