PDB entry 1hh5

View 1hh5 on RCSB PDB site
Description: cytochrome c7 from desulfuromonas acetoxidans
Deposited on 2000-12-21, released 2001-05-03
The last revision prior to the SCOP 1.69 freeze date was dated 2001-05-03, with a file datestamp of 2001-05-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1hh5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hh5A (A:)
    advvtyenkkgnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt
    kcggchik