SCOP 1.73: Domain d1hfoe_: 1hfo E:

Lineage for d1hfoe_ (1hfo E:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (6 families)

5. Family d.80.1.3: MIF-related [55339] (2 proteins)

6. Protein Microphage migration inhibition factor (MIF) [55340] (5 species)
   synonym: glycosylation-inhibiting factor (GIF)

7. Species Trichinella spiralis [TaxId:6334] [64323] (1 PDB entry)

8. Domain d1hfoe_: 1hfo E: [61010]

Details for d1hfoe_

PDB Entry: 1hfo, 1.65 Å

PDB Description: the structure of the macrophage migration inhibitory factor from trichinella spiralis.

PDB Compounds: (E:) migration inhibitory factor

SCOP Domain Sequences for d1hfoe_:

Sequence; same for both SEQRES and ATOM records:

>d1hfoe_ d.80.1.3 (E:) Microphage migration inhibition factor (MIF) {Trichinella spiralis [TaxId: 6334]}
piftlntnikatdvpsdflsstsalvgnilskpgsyvavhintdqqlsfggstnpaafgt
lmsiggiepsrnrdhsaklfdhlntklgipknrmyihfvnlngddvgwngttf

Timeline for d1hfoe_:

• d1hfoe_ first appeared in SCOP 1.57
  
• d1hfoe_ appears in SCOP 1.71
  
• d1hfoe_ appears in SCOP 1.75
  
• d1hfoe_ appears in the current release, SCOPe 2.08