Lineage for d1hfoe_ (1hfo E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2960762Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2960763Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2961019Family d.80.1.3: MIF-related [55339] (3 proteins)
    automatically mapped to Pfam PF01187
  6. 2961039Protein Microphage migration inhibition factor (MIF) [55340] (7 species)
    synonym: glycosylation-inhibiting factor (GIF)
  7. 2961405Species Trichinella spiralis [TaxId:6334] [64323] (1 PDB entry)
  8. 2961410Domain d1hfoe_: 1hfo E: [61010]

Details for d1hfoe_

PDB Entry: 1hfo (more details), 1.65 Å

PDB Description: the structure of the macrophage migration inhibitory factor from trichinella spiralis.
PDB Compounds: (E:) migration inhibitory factor

SCOPe Domain Sequences for d1hfoe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hfoe_ d.80.1.3 (E:) Microphage migration inhibition factor (MIF) {Trichinella spiralis [TaxId: 6334]}
piftlntnikatdvpsdflsstsalvgnilskpgsyvavhintdqqlsfggstnpaafgt
lmsiggiepsrnrdhsaklfdhlntklgipknrmyihfvnlngddvgwngttf

SCOPe Domain Coordinates for d1hfoe_:

Click to download the PDB-style file with coordinates for d1hfoe_.
(The format of our PDB-style files is described here.)

Timeline for d1hfoe_: