Lineage for d1hfoe_ (1hfo E:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81513Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
  4. 81514Superfamily d.80.1: Tautomerase/MIF [55331] (3 families) (S)
  5. 81575Family d.80.1.3: MIF-related [55339] (2 proteins)
  6. 81581Protein Microphage migration inhibition factor (MIF) [55340] (4 species)
  7. 81613Species Trichina (Trichinella spiralis) [64323] (1 PDB entry)
  8. 81618Domain d1hfoe_: 1hfo E: [61010]

Details for d1hfoe_

PDB Entry: 1hfo (more details), 1.65 Å

PDB Description: the structure of the macrophage migration inhibitory factor from trichinella spiralis.

SCOP Domain Sequences for d1hfoe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hfoe_ d.80.1.3 (E:) Microphage migration inhibition factor (MIF) {Trichina (Trichinella spiralis)}
piftlntnikatdvpsdflsstsalvgnilskpgsyvavhintdqqlsfggstnpaafgt
lmsiggiepsrnrdhsaklfdhlntklgipknrmyihfvnlngddvgwngttf

SCOP Domain Coordinates for d1hfoe_:

Click to download the PDB-style file with coordinates for d1hfoe_.
(The format of our PDB-style files is described here.)

Timeline for d1hfoe_: