SCOPe 2.07: Domain d1hf2c2: 1hf2 C:1-99

Lineage for d1hf2c2 (1hf2 C:1-99)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.102: Cell-division inhibitor MinC, N-terminal domain [64042] (1 superfamily)
   beta(2)-(alpha-beta)2-beta; 2 layers, a/b; mixed beta-sheet of 5 strands, order 12345; strands 1 & 5 are antiparallel to the rest

4. Superfamily c.102.1: Cell-division inhibitor MinC, N-terminal domain [64043] (1 family)
   automatically mapped to Pfam PF05209

5. Family c.102.1.1: Cell-division inhibitor MinC, N-terminal domain [64044] (1 protein)

6. Protein Cell-division inhibitor MinC, N-terminal domain [64045] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [64046] (1 PDB entry)

8. Domain d1hf2c2: 1hf2 C:1-99 [60997]
   Other proteins in same PDB: d1hf2a1, d1hf2b1, d1hf2c1, d1hf2d1

Details for d1hf2c2

PDB Entry: 1hf2, 2.2 Å

PDB Description: crystal structure of the bacterial cell-division inhibitor minc from t. maritima

PDB Compounds: (C:) septum site-determining protein minc

SCOPe Domain Sequences for d1hf2c2:

Sequence, based on SEQRES records:

>d1hf2c2 c.102.1.1 (C:1-99) Cell-division inhibitor MinC, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
mvdfkmtkeglvllikdyqnleevlnaisaritqmggffakgdrislmienhnkhsqdip
rivshlrnlglevsqilvgstvegkendlkvqsrttves

Sequence, based on observed residues (ATOM records):

>d1hf2c2 c.102.1.1 (C:1-99) Cell-division inhibitor MinC, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
mvdfkmtkeglvllikdyqnleevlnaisaritqmggffakgdrislmienhnkhsqdip
rivshlrnlglevsqilvgstvedlkvqsrttves

Timeline for d1hf2c2:

• d1hf2c2 first appeared in SCOP 1.57
  
• d1hf2c2 appears in SCOPe 2.06
  
• d1hf2c2 appears in the current release, SCOPe 2.08