Class b: All beta proteins [48724] (178 folds) |
Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.80.3: Cell-division inhibitor MinC, C-terminal domain [63848] (1 family) superhelix turns are made of three short strands each automatically mapped to Pfam PF03775 |
Family b.80.3.1: Cell-division inhibitor MinC, C-terminal domain [63849] (1 protein) this is a repeat family; one repeat unit is 1hf2 A:117-135 found in domain |
Protein Cell-division inhibitor MinC, C-terminal domain [63850] (1 species) |
Species Thermotoga maritima [TaxId:2336] [63851] (1 PDB entry) |
Domain d1hf2c1: 1hf2 C:100-206 [60996] Other proteins in same PDB: d1hf2a2, d1hf2b2, d1hf2c2, d1hf2d2 |
PDB Entry: 1hf2 (more details), 2.2 Å
SCOPe Domain Sequences for d1hf2c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hf2c1 b.80.3.1 (C:100-206) Cell-division inhibitor MinC, C-terminal domain {Thermotoga maritima [TaxId: 2336]} tgkvikrnirsgqtvvhsgdvivfgnvnkgaeilaggsvvvfgkaqgniraglneggqav vaaldlqtsliqiagfithskgeenvpsiahvkgnriviepfdkvsf
Timeline for d1hf2c1: