Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein Biliverdin IX beta reductase [63931] (1 species) Histidine in the active site instead of the Tyr-Lys dyad |
Species Human (Homo sapiens) [TaxId:9606] [63932] (5 PDB entries) |
Domain d1he3a_: 1he3 A: [60967] complexed with mbv, nap |
PDB Entry: 1he3 (more details), 1.4 Å
SCOP Domain Sequences for d1he3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1he3a_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} avkkiaifgatgqtglttlaqavqagyevtvlvrdssrlpsegprpahvvvgdvlqaadv dktvagqdavivllgtrndlspttvmsegarnivaamkahgvdkvvactsafllwdptkv pprlqavtddhirmhkvlresglkyvavmpphigdqpltgaytvtldgrgpsrviskhdl ghfmlrclttdeydghstypshqy
Timeline for d1he3a_: