SCOP 1.61: Domain d1hbxd_: 1hbx D:

Lineage for d1hbxd_ (1hbx D:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.88: SRF-like [55454] (1 superfamily)

4. Superfamily d.88.1: SRF-like [55455] (1 family)

5. Family d.88.1.1: SRF-like [55456] (3 proteins)

6. Protein Serum response factor (SRF) core [55457] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55458] (3 PDB entries)

8. Domain d1hbxd_: 1hbx D: [60932]
   Other proteins in same PDB: d1hbxg_, d1hbxh_

Details for d1hbxd_

PDB Entry: 1hbx, 3.15 Å

PDB Description: ternary complex of sap-1 and srf with specific sre dna

SCOP Domain Sequences for d1hbxd_:

Sequence; same for both SEQRES and ATOM records:

>d1hbxd_ d.88.1.1 (D:) Serum response factor (SRF) core {Human (Homo sapiens)}
kktrgrvkikmefidnklrryttfskrktgimkkayelstltgtqvlllvasetghvytf
atrklqpmitsetgkaliqtclnspd

Timeline for d1hbxd_:

• d1hbxd_ first appeared in SCOP 1.57
  
• d1hbxd_ appears in SCOP 1.59
  
• d1hbxd_ appears in SCOP 1.63
  
• d1hbxd_ appears in the current release, SCOPe 2.08