Lineage for d1hbxd_ (1hbx D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963102Fold d.88: SRF-like [55454] (1 superfamily)
    alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet
  4. 2963103Superfamily d.88.1: SRF-like [55455] (2 families) (S)
  5. 2963104Family d.88.1.1: SRF-like [55456] (5 proteins)
  6. 2963131Protein Serum response factor (SRF) core [55457] (1 species)
  7. 2963132Species Human (Homo sapiens) [TaxId:9606] [55458] (3 PDB entries)
  8. 2963137Domain d1hbxd_: 1hbx D: [60932]
    Other proteins in same PDB: d1hbxg_, d1hbxh_
    protein/DNA complex

Details for d1hbxd_

PDB Entry: 1hbx (more details), 3.15 Å

PDB Description: ternary complex of sap-1 and srf with specific sre dna
PDB Compounds: (D:) serum response factor

SCOPe Domain Sequences for d1hbxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbxd_ d.88.1.1 (D:) Serum response factor (SRF) core {Human (Homo sapiens) [TaxId: 9606]}
kktrgrvkikmefidnklrryttfskrktgimkkayelstltgtqvlllvasetghvytf
atrklqpmitsetgkaliqtclnspd

SCOPe Domain Coordinates for d1hbxd_:

Click to download the PDB-style file with coordinates for d1hbxd_.
(The format of our PDB-style files is described here.)

Timeline for d1hbxd_: