SCOPe 2.06: Domain d1hbod2: 1hbo D:2-269

Lineage for d1hbod2 (1hbo D:2-269)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families)
   each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures

5. Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (3 proteins)
   C-terminal domain is all-alpha

6. Protein Alpha chain [55095] (3 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [55096] (11 PDB entries)

8. Domain d1hbod2: 1hbo D:2-269 [60914]
   Other proteins in same PDB: d1hboa1, d1hbob1, d1hbob2, d1hboc_, d1hbod1, d1hboe1, d1hboe2, d1hbof_
   complexed with cl, com, f43, gol, mg, na, tp7, zn

Details for d1hbod2

PDB Entry: 1hbo, 1.78 Å

PDB Description: methyl-coenzyme m reductase mcr-red1-silent

PDB Compounds: (D:) methyl-coenzyme m reductase I alpha subunit

SCOPe Domain Sequences for d1hbod2:

Sequence; same for both SEQRES and ATOM records:

>d1hbod2 d.58.31.2 (D:2-269) Alpha chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
adklfinalkkkfeespeekkttfytlggwkqserktefvnagkevaakrgipqynpdig
tplgqrvlmpyqvsttdtyvegddlhfvnnaamqqmwddirrtvivglnhahaviekrlg
kevtpetithyletvnhampgaavvqehmvethpalvadsyvkvftgndeiadeidpafv
idinkqfpedqaetlkaevgdgiwqvvriptivsrtcdgattsrwsamqigmsmisaykq
aageaatgdfayaakhaevihmgtylpv

Timeline for d1hbod2:

• d1hbod2 first appeared in SCOP 1.57
  
• d1hbod2 appears in SCOPe 2.05
  
• d1hbod2 appears in SCOPe 2.07
  
• d1hbod2 appears in the current release, SCOPe 2.08