Lineage for d1hboe1 (1hbo E:189-443)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004845Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 2004846Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 2004847Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (3 proteins)
    C-terminal domain is all-alpha
  6. 2004878Protein Beta chain [48087] (3 species)
  7. 2004879Species Methanobacterium thermoautotrophicum [TaxId:145262] [48088] (11 PDB entries)
  8. 2004897Domain d1hboe1: 1hbo E:189-443 [60915]
    Other proteins in same PDB: d1hboa1, d1hboa2, d1hbob2, d1hboc_, d1hbod1, d1hbod2, d1hboe2, d1hbof_
    complexed with cl, com, f43, gol, mg, na, tp7, zn

Details for d1hboe1

PDB Entry: 1hbo (more details), 1.78 Å

PDB Description: methyl-coenzyme m reductase mcr-red1-silent
PDB Compounds: (E:) methyl-coenzyme m reductase I beta subunit

SCOPe Domain Sequences for d1hboe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hboe1 a.89.1.1 (E:189-443) Beta chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
gyalrnimvnhvvaatlkntlqaaalstileqtamfemgdavgafermhllglayqgmna
dnlvfdlvkangkegtvgsviadlveraledgvikvekeltdykvygtddlamwnayaaa
glmaatmvnqgaaraaqgvsstllyyndliefetglpsvdfgkvegtavgfsffshsiyg
gggpgifngnhivtrhskgfaipcvaaamaldagtqmfspeatsglikevfsqvdefrep
lkyvveaaaeiknei

SCOPe Domain Coordinates for d1hboe1:

Click to download the PDB-style file with coordinates for d1hboe1.
(The format of our PDB-style files is described here.)

Timeline for d1hboe1: