| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) ![]() each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
| Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins) C-terminal domain is all-alpha |
| Protein Alpha chain [55095] (3 species) |
| Species Methanobacterium thermoautotrophicum [TaxId:145262] [55096] (11 PDB entries) |
| Domain d1hbnd2: 1hbn D:2-269 [60904] Other proteins in same PDB: d1hbna1, d1hbnb1, d1hbnb2, d1hbnc_, d1hbnd1, d1hbne1, d1hbne2, d1hbnf_ complexed with cl, com, f43, gol, mg, na, tp7, zn |
PDB Entry: 1hbn (more details), 1.16 Å
SCOPe Domain Sequences for d1hbnd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hbnd2 d.58.31.2 (D:2-269) Alpha chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
adklfinalkkkfeespeekkttfytlggwkqserktefvnagkevaakrgipqynpdig
tplgqrvlmpyqvsttdtyvegddlhfvnnaamqqmwddirrtvivglnhahaviekrlg
kevtpetithyletvnhampgaavvqehmvethpalvadsyvkvftgndeiadeidpafv
idinkqfpedqaetlkaevgdgiwqvvriptivsrtcdgattsrwsamqigmsmisaykq
aageaatgdfayaakhaevihmgtylpv
Timeline for d1hbnd2: