Lineage for d1hbnd2 (1hbn D:2-269)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955026Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2955084Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (3 proteins)
    C-terminal domain is all-alpha
  6. 2955085Protein Alpha chain [55095] (3 species)
  7. 2955086Species Methanobacterium thermoautotrophicum [TaxId:145262] [55096] (11 PDB entries)
  8. 2955088Domain d1hbnd2: 1hbn D:2-269 [60904]
    Other proteins in same PDB: d1hbna1, d1hbnb1, d1hbnb2, d1hbnc_, d1hbnd1, d1hbne1, d1hbne2, d1hbnf_
    complexed with cl, com, f43, gol, mg, na, tp7, zn

Details for d1hbnd2

PDB Entry: 1hbn (more details), 1.16 Å

PDB Description: methyl-coenzyme m reductase
PDB Compounds: (D:) methyl-coenzyme m reductase I alpha subunit

SCOPe Domain Sequences for d1hbnd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbnd2 d.58.31.2 (D:2-269) Alpha chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
adklfinalkkkfeespeekkttfytlggwkqserktefvnagkevaakrgipqynpdig
tplgqrvlmpyqvsttdtyvegddlhfvnnaamqqmwddirrtvivglnhahaviekrlg
kevtpetithyletvnhampgaavvqehmvethpalvadsyvkvftgndeiadeidpafv
idinkqfpedqaetlkaevgdgiwqvvriptivsrtcdgattsrwsamqigmsmisaykq
aageaatgdfayaakhaevihmgtylpv

SCOPe Domain Coordinates for d1hbnd2:

Click to download the PDB-style file with coordinates for d1hbnd2.
(The format of our PDB-style files is described here.)

Timeline for d1hbnd2: