Lineage for d1hbna2 (1hbn A:2-269)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1207232Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 1207266Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)
    C-terminal domain is all-alpha
  6. 1207267Protein Alpha chain [55095] (3 species)
  7. 1207268Species Methanobacterium thermoautotrophicum [TaxId:145262] [55096] (5 PDB entries)
  8. 1207269Domain d1hbna2: 1hbn A:2-269 [60899]
    Other proteins in same PDB: d1hbna1, d1hbnb1, d1hbnb2, d1hbnc_, d1hbnd1, d1hbne1, d1hbne2, d1hbnf_
    complexed with cl, com, f43, gol, mg, na, tp7, zn

Details for d1hbna2

PDB Entry: 1hbn (more details), 1.16 Å

PDB Description: methyl-coenzyme m reductase
PDB Compounds: (A:) methyl-coenzyme m reductase I alpha subunit

SCOPe Domain Sequences for d1hbna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbna2 d.58.31.2 (A:2-269) Alpha chain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
adklfinalkkkfeespeekkttfytlggwkqserktefvnagkevaakrgipqynpdig
tplgqrvlmpyqvsttdtyvegddlhfvnnaamqqmwddirrtvivglnhahaviekrlg
kevtpetithyletvnhampgaavvqehmvethpalvadsyvkvftgndeiadeidpafv
idinkqfpedqaetlkaevgdgiwqvvriptivsrtcdgattsrwsamqigmsmisaykq
aageaatgdfayaakhaevihmgtylpv

SCOPe Domain Coordinates for d1hbna2:

Click to download the PDB-style file with coordinates for d1hbna2.
(The format of our PDB-style files is described here.)

Timeline for d1hbna2: