Lineage for d1hbmf_ (1hbm F:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 505371Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (2 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 505372Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (1 protein)
  6. 505373Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species)
  7. 505374Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (5 PDB entries)
  8. 505382Domain d1hbmf_: 1hbm F: [60897]
    Other proteins in same PDB: d1hbma1, d1hbma2, d1hbmb1, d1hbmb2, d1hbmd1, d1hbmd2, d1hbme1, d1hbme2

Details for d1hbmf_

PDB Entry: 1hbm (more details), 1.8 Å

PDB Description: methyl-coenzyme m reductase enzyme product complex

SCOP Domain Sequences for d1hbmf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hbmf_ d.58.31.1 (F:) Methyl-coenzyme M reductase gamma chain {Archaeon Methanobacterium thermoautotrophicum}
aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr
sqggfnl

SCOP Domain Coordinates for d1hbmf_:

Click to download the PDB-style file with coordinates for d1hbmf_.
(The format of our PDB-style files is described here.)

Timeline for d1hbmf_: