SCOP 1.73: Domain d1ha3b3: 1ha3 B:3-212

Lineage for d1ha3b3 (1ha3 B:3-212)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)

7. Species Thermus thermophilus [TaxId:274] [52629] (7 PDB entries)

8. Domain d1ha3b3: 1ha3 B:3-212 [60874]
   Other proteins in same PDB: d1ha3a1, d1ha3a2, d1ha3b1, d1ha3b2
   complexed with bme, gdp, mau, mg

Details for d1ha3b3

PDB Entry: 1ha3, 2 Å

PDB Description: elongation factor tu in complex with aurodox

PDB Compounds: (B:) elongation factor tu

SCOP Domain Sequences for d1ha3b3:

Sequence, based on SEQRES records:

>d1ha3b3 c.37.1.8 (B:3-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
gefirtkphvnvgtighvdhgkttltaaltfvtaaenpnvevkdygdidkapeerargit
intahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehill
arqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqm
hrnpktrrgenewvdkiwelldaideyipt

Sequence, based on observed residues (ATOM records):

>d1ha3b3 c.37.1.8 (B:3-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
gefirtkphvnvgtighvdhgkttltaaltfvtaaenpnahveyetakrhyshvdcpgha
dyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgvpyivvfmnkvdmvddpel
ldlvemevrdllnqyefpgdevpvirgsallaleqmhrnpktrrgenewvdkiwelldai
deyipt

Timeline for d1ha3b3:

• d1ha3b3 first appeared in SCOP 1.57
  
• d1ha3b3 appears in SCOP 1.71
  
• d1ha3b3 appears in SCOP 1.75
  
• d1ha3b3 appears in the current release, SCOPe 2.08