Lineage for d1ha3b3 (1ha3 B:3-212)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2110458Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 2110491Species Thermus thermophilus [TaxId:274] [52629] (4 PDB entries)
  8. 2110494Domain d1ha3b3: 1ha3 B:3-212 [60874]
    Other proteins in same PDB: d1ha3a1, d1ha3a2, d1ha3b1, d1ha3b2
    complexed with bme, gdp, mau, mg

Details for d1ha3b3

PDB Entry: 1ha3 (more details), 2 Å

PDB Description: elongation factor tu in complex with aurodox
PDB Compounds: (B:) elongation factor tu

SCOPe Domain Sequences for d1ha3b3:

Sequence, based on SEQRES records: (download)

>d1ha3b3 c.37.1.8 (B:3-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
gefirtkphvnvgtighvdhgkttltaaltfvtaaenpnvevkdygdidkapeerargit
intahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehill
arqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqm
hrnpktrrgenewvdkiwelldaideyipt

Sequence, based on observed residues (ATOM records): (download)

>d1ha3b3 c.37.1.8 (B:3-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
gefirtkphvnvgtighvdhgkttltaaltfvtaaenpnahveyetakrhyshvdcpgha
dyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgvpyivvfmnkvdmvddpel
ldlvemevrdllnqyefpgdevpvirgsallaleqmhrnpktrrgenewvdkiwelldai
deyipt

SCOPe Domain Coordinates for d1ha3b3:

Click to download the PDB-style file with coordinates for d1ha3b3.
(The format of our PDB-style files is described here.)

Timeline for d1ha3b3: