SCOPe 2.05: Domain d1h9xb1: 1h9x B:39-133

Lineage for d1h9xb1 (1h9x B:39-133)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)

6. Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)
   the C-terminal domain is a 8-bladed beta-propeller

7. Species Paracoccus pantotrophus [TaxId:82367] [46673] (11 PDB entries)
   formerly Thiosphaera pantotropha

8. Domain d1h9xb1: 1h9x B:39-133 [60857]
   Other proteins in same PDB: d1h9xa2, d1h9xb2
   complexed with dhe, hec, nhe, so4

Details for d1h9xb1

PDB Entry: 1h9x, 2.1 Å

PDB Description: cytochrome cd1 nitrite reductase, reduced form

PDB Compounds: (B:) cytochrome cd1 nitrite reductase

SCOPe Domain Sequences for d1h9xb1:

Sequence; same for both SEQRES and ATOM records:

>d1h9xb1 a.3.1.2 (B:39-133) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus [TaxId: 82367]}
apgapegvsalsdaqyneankiyfercagchgvlrkgatgkaltpdltrdlgfdylqsfi
tygspagmpnwgtsgelsaeqvdlmanyllldpaa

Timeline for d1h9xb1:

• d1h9xb1 first appeared in SCOP 1.57
  
• d1h9xb1 appears in SCOPe 2.04
  
• d1h9xb1 appears in SCOPe 2.06
  
• d1h9xb1 appears in the current release, SCOPe 2.08