Lineage for d1h9xb1 (1h9x B:39-133)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45210Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)
  6. 45211Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)
  7. 45217Species Paracoccus pantotrophus [TaxId:82367] [46673] (10 PDB entries)
  8. 45231Domain d1h9xb1: 1h9x B:39-133 [60857]
    Other proteins in same PDB: d1h9xa2, d1h9xb2

Details for d1h9xb1

PDB Entry: 1h9x (more details), 2.1 Å

PDB Description: cytochrome cd1 nitrite reductase, reduced form

SCOP Domain Sequences for d1h9xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h9xb1 a.3.1.2 (B:39-133) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus}
apgapegvsalsdaqyneankiyfercagchgvlrkgatgkaltpdltrdlgfdylqsfi
tygspagmpnwgtsgelsaeqvdlmanyllldpaa

SCOP Domain Coordinates for d1h9xb1:

Click to download the PDB-style file with coordinates for d1h9xb1.
(The format of our PDB-style files is described here.)

Timeline for d1h9xb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h9xb2