Lineage for d1h9ga1 (1h9g A:5-78)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 351236Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 351617Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families) (S)
    contains a small beta-sheet (wing)
  5. 351692Family a.4.5.6: GntR-like transcriptional regulators [46804] (1 protein)
  6. 351693Protein Fatty acid responsive transcription factor FadR, N-terminal domain [46805] (1 species)
  7. 351694Species Escherichia coli [TaxId:562] [46806] (5 PDB entries)
  8. 351698Domain d1h9ga1: 1h9g A:5-78 [60827]
    Other proteins in same PDB: d1h9ga2
    complexed with coa, myr

Details for d1h9ga1

PDB Entry: 1h9g (more details), 2.1 Å

PDB Description: fadr, fatty acid responsive transcription factor from e. coli, in complex with myristoyl-coa

SCOP Domain Sequences for d1h9ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h9ga1 a.4.5.6 (A:5-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli}
aqspagfaeeyiiesiwnnrfppgtilpaerelseligvtrttlrevlqrlardgwltiq
hgkptkvnnfwets

SCOP Domain Coordinates for d1h9ga1:

Click to download the PDB-style file with coordinates for d1h9ga1.
(The format of our PDB-style files is described here.)

Timeline for d1h9ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h9ga2