Lineage for d1h9dc_ (1h9d C:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 938438Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 938790Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 939015Family b.2.5.6: RUNT domain [81318] (2 proteins)
  6. 939016Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species)
    synonym: core binding factor alpha, cbfa
  7. 939017Species Human (Homo sapiens) [TaxId:9606] [49440] (5 PDB entries)
  8. 939021Domain d1h9dc_: 1h9d C: [60823]
    Other proteins in same PDB: d1h9db_, d1h9dd_
    protein/DNA complex

Details for d1h9dc_

PDB Entry: 1h9d (more details), 2.6 Å

PDB Description: aml1/cbf-beta/dna complex
PDB Compounds: (C:) core-binding factor alpha subunit1

SCOPe Domain Sequences for d1h9dc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h9dc_ b.2.5.6 (C:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Human (Homo sapiens) [TaxId: 9606]}
vladhpgelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndeny
saelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgp
reprr

SCOPe Domain Coordinates for d1h9dc_:

Click to download the PDB-style file with coordinates for d1h9dc_.
(The format of our PDB-style files is described here.)

Timeline for d1h9dc_: