SCOP 1.57: Domain d1h9dc_: 1h9d C:

Lineage for d1h9dc_ (1h9d C:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)

4. Superfamily b.2.5: p53-like transcription factors [49417] (1 family)

5. Family b.2.5.1: p53-like transcription factors [49418] (10 proteins)

6. Protein Acute myeloid leukemia 1 protein (AML1), RUNT domain [49439] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49440] (4 PDB entries)

8. Domain d1h9dc_: 1h9d C: [60823]
   Other proteins in same PDB: d1h9db_, d1h9dd_

Details for d1h9dc_

PDB Entry: 1h9d, 2.6 Å

PDB Description: aml1/cbf-beta/dna complex

SCOP Domain Sequences for d1h9dc_:

Sequence; same for both SEQRES and ATOM records:

>d1h9dc_ b.2.5.1 (C:) Acute myeloid leukemia 1 protein (AML1), RUNT domain {Human (Homo sapiens)}
vladhpgelvrtdspnflcsvlpthwrcnktlpiafkvvalgdvpdgtlvtvmagndeny
saelrnataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgp
reprr

Timeline for d1h9dc_:

• d1h9dc_ is new in SCOP 1.57
  
• d1h9dc_ appears in SCOP 1.59
  
• d1h9dc_ appears in the current release, SCOPe 2.08