SCOPe 2.08: Domain d1h8hg_: 1h8h G:

Lineage for d1h8hg_ (1h8h G:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest

4. Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families)
   contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold

5. Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein)
   automatically mapped to Pfam PF00231

6. Protein F1 ATP synthase gamma subunit [52945] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52946] (19 PDB entries)
   Uniprot P05631

8. Domain d1h8hg_: 1h8h G: [60777]
   Other proteins in same PDB: d1h8ha1, d1h8ha2, d1h8ha3, d1h8hb1, d1h8hb2, d1h8hb3, d1h8hc1, d1h8hc2, d1h8hc3, d1h8hd1, d1h8hd2, d1h8hd3, d1h8he1, d1h8he2, d1h8he3, d1h8hf1, d1h8hf2, d1h8hf3
   core domain is disordered; only coiled coil part is visible
   complexed with adp, atp, gol, mg, po4
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1h8hg_

PDB Entry: 1h8h, 2.9 Å

PDB Description: bovine mitochondrial f1-atpase crystallised in the presence of 5mm amppnp

PDB Compounds: (G:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1h8hg_:

Sequence, based on SEQRES records:

>d1h8hg_ c.49.2.1 (G:) F1 ATP synthase gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
emidkltltfnrtrqavitkelieiisgaaal

Sequence, based on observed residues (ATOM records):

>d1h8hg_ c.49.2.1 (G:) F1 ATP synthase gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvylcgaihssvakqmkla
niiyyslkesttseqsarmtamdnasknasemidkltltfnrtrqavitkelieiisgaa
al

Timeline for d1h8hg_:

• d1h8hg_ first appeared in SCOP 1.57
  
• d1h8hg_ appears in SCOPe 2.07