| Class b: All beta proteins [48724] (180 folds) |
| Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) ![]() automatically mapped to Pfam PF02874 |
| Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (3 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
| Protein F1 ATP synthase alpha subunit, domain 1 [88672] (5 species) |
| Species Cow (Bos taurus) [TaxId:9913] [88673] (15 PDB entries) Uniprot P19483 |
| Domain d1h8hc2: 1h8h C:19-94 [60766] Other proteins in same PDB: d1h8ha1, d1h8ha3, d1h8hb1, d1h8hb3, d1h8hc1, d1h8hc3, d1h8hd1, d1h8hd2, d1h8hd3, d1h8he1, d1h8he2, d1h8he3, d1h8hf1, d1h8hf2, d1h8hf3, d1h8hg_ complexed with adp, atp, gol, mg, po4 |
PDB Entry: 1h8h (more details), 2.9 Å
SCOPe Domain Sequences for d1h8hc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h8hc2 b.49.1.1 (C:19-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
adtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgn
dklikegdivkrtgai
Timeline for d1h8hc2: