SCOP 1.57: Domain d1h8ha1: 1h8h A:380-510

Lineage for d1h8ha1 (1h8h A:380-510)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.69: Left-handed superhelix [47916] (2 superfamilies)

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)

6. Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47920] (9 PDB entries)

8. Domain d1h8ha1: 1h8h A:380-510 [60759]
   Other proteins in same PDB: d1h8ha2, d1h8ha3, d1h8hb2, d1h8hb3, d1h8hc2, d1h8hc3, d1h8hd2, d1h8hd3, d1h8he2, d1h8he3, d1h8hf2, d1h8hf3, d1h8hg_

Details for d1h8ha1

PDB Entry: 1h8h, 2.9 Å

PDB Description: bovine mitochondrial f1-atpase crystallised in the presence of 5mm amppnp

SCOP Domain Sequences for d1h8ha1:

Sequence; same for both SEQRES and ATOM records:

>d1h8ha1 a.69.1.1 (A:380-510) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

Timeline for d1h8ha1:

• d1h8ha1 is new in SCOP 1.57
  
• d1h8ha1 appears in SCOP 1.59
  
• d1h8ha1 appears in the current release, SCOPe 2.08