Lineage for d1h8ha2 (1h8h A:24-94)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61155Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
  4. 61156Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 61157Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)
  6. 61158Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species)
  7. 61162Species Cow (Bos taurus) [TaxId:9913] [50618] (9 PDB entries)
  8. 61205Domain d1h8ha2: 1h8h A:24-94 [60760]
    Other proteins in same PDB: d1h8ha1, d1h8ha3, d1h8hb1, d1h8hb3, d1h8hc1, d1h8hc3, d1h8hd1, d1h8hd3, d1h8he1, d1h8he3, d1h8hf1, d1h8hf3, d1h8hg_

Details for d1h8ha2

PDB Entry: 1h8h (more details), 2.9 Å

PDB Description: bovine mitochondrial f1-atpase crystallised in the presence of 5mm amppnp

SCOP Domain Sequences for d1h8ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8ha2 b.49.1.1 (A:24-94) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

SCOP Domain Coordinates for d1h8ha2:

Click to download the PDB-style file with coordinates for d1h8ha2.
(The format of our PDB-style files is described here.)

Timeline for d1h8ha2: