| Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
| Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) ![]() |
| Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (6 proteins) |
| Protein Central domain of alpha and beta subunits of F1 ATP synthase [52678] (4 species) |
| Species Cow (Bos taurus) [TaxId:9913] [52679] (9 PDB entries) |
| Domain d1h8hd3: 1h8h D:82-357 [60770] Other proteins in same PDB: d1h8ha1, d1h8ha2, d1h8hb1, d1h8hb2, d1h8hc1, d1h8hc2, d1h8hd1, d1h8hd2, d1h8he1, d1h8he2, d1h8hf1, d1h8hf2, d1h8hg_ |
PDB Entry: 1h8h (more details), 2.9 Å
SCOP Domain Sequences for d1h8hd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h8hd3 c.37.1.11 (D:82-357) Central domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri
Timeline for d1h8hd3: