SCOP 1.69: Domain d1h73a2: 1h73 A:168-300

Lineage for d1h73a2 (1h73 A:168-300)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (7 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.26.1: Homoserine kinase [55061] (1 protein)

6. Protein Homoserine kinase [55062] (1 species)

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [55063] (5 PDB entries)

8. Domain d1h73a2: 1h73 A:168-300 [60715]
   Other proteins in same PDB: d1h73a1

Details for d1h73a2

PDB Entry: 1h73, 2 Å

PDB Description: crystal structure of homoserine kinase complexed with threonine

SCOP Domain Sequences for d1h73a2:

Sequence; same for both SEQRES and ATOM records:

>d1h73a2 d.58.26.1 (A:168-300) Homoserine kinase {Archaeon Methanococcus jannaschii}
fkldiliaipnisintkeareilpkavglkdlvnnvgkacgmvyalynkdkslfgrymms
dkviepvrgklipnyfkikeevkdkvygitisgsgpsiiafpkeefidevenilrdyyen
tirtevgkgvevv

Timeline for d1h73a2:

• d1h73a2 first appeared in SCOP 1.57
  
• d1h73a2 appears in SCOP 1.67
  
• d1h73a2 appears in SCOP 1.71
  
• d1h73a2 appears in the current release, SCOPe 2.08