Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (7 families) common fold is elaborated with additional secondary structures |
Family d.58.26.1: Homoserine kinase [55061] (1 protein) |
Protein Homoserine kinase [55062] (1 species) |
Species Archaeon Methanococcus jannaschii [TaxId:2190] [55063] (5 PDB entries) |
Domain d1h73a2: 1h73 A:168-300 [60715] Other proteins in same PDB: d1h73a1 complexed with anp, thr |
PDB Entry: 1h73 (more details), 2 Å
SCOP Domain Sequences for d1h73a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h73a2 d.58.26.1 (A:168-300) Homoserine kinase {Archaeon Methanococcus jannaschii} fkldiliaipnisintkeareilpkavglkdlvnnvgkacgmvyalynkdkslfgrymms dkviepvrgklipnyfkikeevkdkvygitisgsgpsiiafpkeefidevenilrdyyen tirtevgkgvevv
Timeline for d1h73a2: