Lineage for d1h6kc2 (1h6k C:291-480)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1745106Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 1745477Family a.118.1.14: MIF4G domain-like [100908] (6 proteins)
    duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
    this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain
  6. 1745478Protein CBP80, 80KDa nuclear cap-binding protein [63606] (1 species)
    contains three domains of this fold connected with long linkers
  7. 1745479Species Human (Homo sapiens) [TaxId:9606] [63607] (6 PDB entries)
  8. 1745487Domain d1h6kc2: 1h6k C:291-480 [60682]
    Other proteins in same PDB: d1h6kx_, d1h6ky_, d1h6kz_
    protein/RNA complex

Details for d1h6kc2

PDB Entry: 1h6k (more details), 2 Å

PDB Description: nuclear cap binding complex
PDB Compounds: (C:) cbp80

SCOPe Domain Sequences for d1h6kc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6kc2 a.118.1.14 (C:291-480) CBP80, 80KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}
mfdytddpegpvmpgshsverfvieenlhciikshwkerktcaaqlvsypgknkiplnyh
ivevifaelfqlpapphidvmyttllielcklqpgslpqvlaqatemlymrldtmnttcv
drfinwfshhlsnfqfrwswedwsdclsqdpespkpkfvrevlekcmrlsyhqrildivp
ptfsalcpsn

SCOPe Domain Coordinates for d1h6kc2:

Click to download the PDB-style file with coordinates for d1h6kc2.
(The format of our PDB-style files is described here.)

Timeline for d1h6kc2: