Class a: All alpha proteins [46456] (286 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (26 families) |
Family a.118.1.14: MIF4G domain-like [100908] (6 proteins) duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain |
Protein CBP80, 80KDa nuclear cap-binding protein [63606] (1 species) contains three domains of this fold connected with long linkers |
Species Human (Homo sapiens) [TaxId:9606] [63607] (6 PDB entries) |
Domain d1h6kb3: 1h6k B:481-790 [60680] Other proteins in same PDB: d1h6kx_, d1h6ky_, d1h6kz_ protein/RNA complex |
PDB Entry: 1h6k (more details), 2 Å
SCOPe Domain Sequences for d1h6kb3:
Sequence, based on SEQRES records: (download)
>d1h6kb3 a.118.1.14 (B:481-790) CBP80, 80KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} ptciykygdessnslpghsvalclavafkskatndeifsilkdvpnpnqdddddegfsfn plkievfvqtllhlaaksfshsfsalakfhevfktlaesdegklhvlrvmfevwrnhpqm iavlvdkmirtqivdcaavanwifsselsrdftrlfvweilhstirkmnkhvlkiqkele eakeklarqhdgvleeqierlqekvesaqseqknlflvifqrfimiltehlvrcetdgts vltpwykncierlqqiflqhhqiiqqymvtlenllftaeldphilavfqqfcalqa
>d1h6kb3 a.118.1.14 (B:481-790) CBP80, 80KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} ptciykygdessnslpghsvalclavafkskatndeifsilkdvpnfnplkievfvqtll hlaaksfshsfsalakfhevfktlaesdegklhvlrvmfevwrnhpqmiavlvdkmirtq ivdcaavanwifsselsrdftrlfvweilhstirkmnkhvlkiqkeleeakeeeqierlq ekvesaqseqknlflvifqrfimiltehlvrcetdgtsvltpwykncierlqqiflqhhq iiqqymvtlenllftaeldphilavfqqfcalqa
Timeline for d1h6kb3: