SCOPe 2.04: Domain d1h4vb1: 1h4v B:326-421

Lineage for d1h4vb1 (1h4v B:326-421)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families)

5. Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins)

6. Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (4 species)

7. Species Thermus thermophilus [TaxId:274] [52959] (3 PDB entries)

8. Domain d1h4vb1: 1h4v B:326-421 [60624]
   Other proteins in same PDB: d1h4vb2
   complexed with so4

Details for d1h4vb1

PDB Entry: 1h4v, 2.4 Å

PDB Description: histidyl-trna synthetase from thermus thermophilus (ligand free)

PDB Compounds: (B:) histidyl-tRNA synthetase

SCOPe Domain Sequences for d1h4vb1:

Sequence; same for both SEQRES and ATOM records:

>d1h4vb1 c.51.1.1 (B:326-421) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermus thermophilus [TaxId: 274]}
ekgpdlyliplteeavaeafylaealrprlraeyalaprkpakgleealkrgaafagflg
edelragevtlkrlatgeqvrlsreevpgyllqalg

Timeline for d1h4vb1:

• d1h4vb1 first appeared in SCOP 1.57
  
• d1h4vb1 appears in SCOPe 2.03
  
• d1h4vb1 appears in SCOPe 2.05
  
• d1h4vb1 appears in the current release, SCOPe 2.08