Lineage for d1h4vb1 (1h4v B:326-421)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies) 
Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) 
Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins) 
Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (3 species) Species Thermus thermophilus [TaxId:274] [52959] (3 PDB entries) 
Domain d1h4vb1: 1h4v B:326-421 [60624]
Other proteins in same PDB: d1h4vb2
Details for d1h4vb1
PDB Entry: 1h4v (more details), 2.4 Å
PDB Description: histidyl-trna synthetase from thermus thermophilus (ligand free)
SCOP Domain Sequences for d1h4vb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h4vb1 c.51.1.1 (B:326-421) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermus thermophilus}
ekgpdlyliplteeavaeafylaealrprlraeyalaprkpakgleealkrgaafagflg
edelragevtlkrlatgeqvrlsreevpgyllqalg
SCOP Domain Coordinates for d1h4vb1:
Click to download the PDB-style file with coordinates for d1h4vb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h4vb1:
- d1h4vb1 is new in SCOP 1.57
- d1h4vb1 appears in SCOP 1.59
- d1h4vb1 appears in the current release, SCOPe 2.08
View in 3D
