Lineage for d1h4vb1 (1h4v B:326-421)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245573Fold c.51: Anticodon-binding domain-like [52953] (4 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 245574Superfamily c.51.1: Anticodon-binding domain of Class II aaRS [52954] (1 family) (S)
  5. 245575Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (5 proteins)
  6. 245584Protein Histidyl-tRNA synthetase (HisRS), C-terminal domain [52956] (3 species)
  7. 245601Species Thermus thermophilus [TaxId:274] [52959] (3 PDB entries)
  8. 245602Domain d1h4vb1: 1h4v B:326-421 [60624]
    Other proteins in same PDB: d1h4vb2
    complexed with so4

Details for d1h4vb1

PDB Entry: 1h4v (more details), 2.4 Å

PDB Description: histidyl-trna synthetase from thermus thermophilus (ligand free)

SCOP Domain Sequences for d1h4vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4vb1 c.51.1.1 (B:326-421) Histidyl-tRNA synthetase (HisRS), C-terminal domain {Thermus thermophilus}
ekgpdlyliplteeavaeafylaealrprlraeyalaprkpakgleealkrgaafagflg
edelragevtlkrlatgeqvrlsreevpgyllqalg

SCOP Domain Coordinates for d1h4vb1:

Click to download the PDB-style file with coordinates for d1h4vb1.
(The format of our PDB-style files is described here.)

Timeline for d1h4vb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h4vb2