| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.1: Class II aaRS ABD-related [52954] (2 families) ![]() |
| Family c.51.1.1: Anticodon-binding domain of Class II aaRS [52955] (6 proteins) |
| Protein Prolyl-tRNA synthetase (ProRS) domain [64071] (3 species) |
| Species Thermus thermophilus [TaxId:274] [64072] (4 PDB entries) |
| Domain d1h4ta1: 1h4t A:277-403 [60610] Other proteins in same PDB: d1h4ta2, d1h4ta3, d1h4tb2, d1h4tb3, d1h4tc2, d1h4tc3, d1h4td2, d1h4td3 protein/RNA complex; complexed with pro, zn |
PDB Entry: 1h4t (more details), 2.9 Å
SCOPe Domain Sequences for d1h4ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h4ta1 c.51.1.1 (A:277-403) Prolyl-tRNA synthetase (ProRS) domain {Thermus thermophilus [TaxId: 274]}
rglvlpprlapiqvvivpiykdesrervleaaqglrqallaqglrvhlddrdqhtpgykf
hewelkgvpfrvelgpkdleggqavlasrlggketlplaalpealpgkldafheelyrra
lafredh
Timeline for d1h4ta1: